PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g005920.1.1
Common NameLOC101248635
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 688aa    MW: 76250.6 Da    PI: 4.6348
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g005920.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.16.4e-4841311128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtd el+++yLk+k++gkkl++ e i+e++iyk+ PwdLp k ++k+++ ewyfF++r++kya+g r nrat++gyWk+tgkd
  Solyc11g005920.1.1   4 LPPGFRFHPTDVELIMYYLKRKITGKKLHF-EGITELNIYKFSPWDLPdKcCYKSKDLEWYFFCPRERKYASGARMNRATDTGYWKTTGKD 93 
                         79**************************99.78***************6545666777********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v+   ++ vg  ktLvf+ g+ p+g++tdWv+hey++
  Solyc11g005920.1.1  94 RPVTY-CEKIVGSVKTLVFHLGHPPRGKRTDWVIHEYKF 131
                         *****.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.5E-572154IPR003441NAC domain
PROSITE profilePS5100554.2914154IPR003441NAC domain
PfamPF023653.2E-245130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
MARLPPGFRF HPTDVELIMY YLKRKITGKK LHFEGITELN IYKFSPWDLP DKCCYKSKDL  60
EWYFFCPRER KYASGARMNR ATDTGYWKTT GKDRPVTYCE KIVGSVKTLV FHLGHPPRGK  120
RTDWVIHEYK FEDKESIDAG FAQDSYVLCK VFQKSGPGPK NGAQYGAPFK EEDWEDDKIP  180
AEPCTSDVFP APPGRTDKPS GSNAIRMVDP RSTSDWTSSE QSPSPIQPSV QKLPLDEPDD  240
EELPGEPNLS NVSSINWRPS DQLKAKPSNT FSALPILPEE QSCSVDTGLV NPGPGPSNAQ  300
MCTNEMALDD IDDEMIGLFA PFTEDTSLLS GGSEPNQKLD NFHQEVNAPP AACTDGNDIF  360
DGLGDIEFWA GVGQLEPDLT ASGGANHSLN PVILPQEAPQ DAAYMELNDL DIPLNHPAET  420
IGTGQLVPGY FCTPYNSNNG MQQLCFGSNS LGIVQDFGEH HLPALPESYT QQVNHPDMAY  480
NFLNNPNQGY NAATNFSVSS YKQPEDRRLD TQNLERGVQQ QKFYLSIFAL CDGSFLLVKA  540
EVTLGVDGCT NDALSVILGE QRKLYLSIFA FCGGPFILVK AEVTLGVDGC TNDALSVILG  600
NPSFTSTRVS NVDKADFSKK THEAFCFGFS LAFIRFSCVG MLWLNSLWEL YQFIVFKILL  660
NQVQFNSSGT SFHLHFHLSY IANYAVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-45415415168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.45980.0cell culture| flower| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0136830.0Lycopersicon esculentum clone 132505F, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010312481.10.0PREDICTED: uncharacterized protein LOC101248635
RefseqXP_004249904.10.0PREDICTED: uncharacterized protein LOC101248635
TrEMBLK4D4K50.0K4D4K5_SOLLC; Uncharacterized protein
STRINGSolyc11g005920.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60502334
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.45e-83NAC domain containing protein 82
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]